PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g07480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 308aa    MW: 34523.8 Da    PI: 6.9004
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g07480.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.6e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++lvd+++++G g+W++ ++  g++R++k+c++rw +yl
   Vang07g07480.1 14 KGPWSPEEDKILVDYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.31.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++l++++++ lG++ W++Ia++++ gRt++++k+ w+++l
   Vang07g07480.1  67 RGKFSDEEEQLIINLHAVLGNK-WAAIASHLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.629961IPR017930Myb domain
SuperFamilySSF466899.54E-3211108IPR009057Homeodomain-like
SMARTSM007171.7E-151363IPR001005SANT/Myb domain
PfamPF002499.0E-181461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-251568IPR009057Homeodomain-like
CDDcd001673.45E-121661No hitNo description
PROSITE profilePS5129426.50862116IPR017930Myb domain
SMARTSM007174.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2769116IPR009057Homeodomain-like
CDDcd001671.29E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MMRTPSSDES GLKKGPWSPE EDKILVDYIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SDEEEQLIIN LHAVLGNKWA AIASHLPGRT DNEIKNLWNT HLRKKLLQMG  120
LDPVTHRPRT DHLNLLTNLQ QILEAAKIVS SFTNPCDINN ALRLHSDVTQ LAKFQLLQNM  180
FQLTGATPSP SSLTDGFLND VLGFNQCSNL QNLHDGNSVS QILPNVQNFE ALQLPSPSNS  240
LPNLVSASPE HSPVKAENFN ANSKECCNPS STTFELTWGD FMEEDATDNY WKGFIDQHSN  300
QTWSTVQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520504.10.0PREDICTED: transcription repressor MYB6-like
SwissprotQ8GWP02e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0S3T6680.0A0A0S3T668_PHAAN; Uncharacterized protein
STRINGGLYMA01G44370.21e-148(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.24e-92myb domain protein 9